Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF

Interleukin 27 EBI3 (IL-27 EBI3) predicts a molecular mass of 23.4 kDa. IL-27 is a heterodimeric cytokine that is encoded by Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. It is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R) .

Product Specifications

Synonyms

IL-27, Interleukin-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3

Gene Name

EBI3

UniProt

O35228

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 23.84 kDa. The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Transferrin Receptor 1 Antibody
RC-5430-01 50 μL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-5430-02 100 µL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-5430-03 1 mL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Cortisol 21-Benzoate
TRC-C696310-5MG 5 mg

Cortisol 21-Benzoate

Sign In for Pricing
View Details
PPP1R12A Antibody
KC-3359-01 50 μL

PPP1R12A Antibody

Sign In for Pricing
View Details
PPP1R12A Antibody
KC-3359-02 100 µL

PPP1R12A Antibody

Sign In for Pricing
View Details