Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

C-X-C motif chemokine 11 (CXCL11) also named Interferon-gamma-inducible protein 9 (IP-9), which is a chemokine of the intercrine alpha family. CXCL11 is a 8.1kDa protein containing 73 amino acid residues. To CXCR3, CXCL11 has higher affinity than CXCL10 and CXCL9 which plays a role in immune activation. CXCL11 induces the activation of T cells which is also a chemotaxis for T cells. The CXCL11 produced in response for IFN Family.

Product Specifications

Synonyms

Interferon Inducible T-Cell α Chemokine, I-TAC, B-R1

Gene Name

CXCL11

UniProt

O14625

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.11 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-01 0.02 mg (E-Coli)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-02 0.02 mg (Yeast)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-03 0.1 mg (E-Coli)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-04 0.1 mg (Yeast)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-05 0.02 mg (Baculovirus)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)
MBS1173479-06 0.02 mg (Mammalian-Cell)

Recombinant Azospirillum brasilense Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details