Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

C-X-C motif chemokine 11 (CXCL11) also named Interferon-gamma-inducible protein 9 (IP-9), which is a chemokine of the intercrine alpha family. CXCL11 is a 8.1kDa protein containing 73 amino acid residues. To CXCR3, CXCL11 has higher affinity than CXCL10 and CXCL9 which plays a role in immune activation. CXCL11 induces the activation of T cells which is also a chemotaxis for T cells. The CXCL11 produced in response for IFN Family.

Product Specifications

Synonyms

Interferon Inducible T-Cell α Chemokine, I-TAC, B-R1

Gene Name

CXCL11

UniProt

O14625

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.11 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit
abx585711-01 96 Tests

Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit
abx585711-02 5x 96 Tests

Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit
abx585711-03 10x 96 Tests

Low Sample Volume Mouse Interleukin-1 Receptor-Like 1 (IL1RL1) ELISA Kit

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) discontinued
537259-01 30ul

Histone H2A.X, phosphorylated (Ser139) discontinued

Sign In for Pricing
View Details
Histone H2A.X, phosphorylated (Ser139) discontinued
537259-02 100 µL

Histone H2A.X, phosphorylated (Ser139) discontinued

Sign In for Pricing
View Details
Mouse Dnd1 Pre-designed siRNA Set B
SI103808B 1 Each

Mouse Dnd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details