Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Galectin-9 protein, AF

Galectin-9 (Gal-9) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for β-galactoside binding, and several binding partners for galectin-9 have been identified, including CD44, FGL, Gcgr, GLUT- 2, IgE, IgM, PDI, and Tim-3. Galectin-9 is constitutively presented in the small intestine, liver, uterine epithelial cells, skin epidermis, and esophageal epithelium. Galectin-9 contributing to cell growth, differentiation, adhesion, communication, and death. Accumulated evidence indicates that Gal-9 blockade promotes T cell immunity against tumors, suggesting that galectin-9 is a promising target for immunotherapy.

Product Specifications

Synonyms

LGALS9, HUATA, LGALS9

Gene Name

LGALS9

UniProt

O00182

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is <3 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 36.7 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PIBF1 (Progesterone Immunomodulatory Binding Factor 1) ELISA Kit
EH24340 96 Tests

Human PIBF1 (Progesterone Immunomodulatory Binding Factor 1) ELISA Kit

Sign In for Pricing
View Details
CHST11 Polyclonal Antibody, APC-Cy7 Conjugated
bs-13930R-APC-Cy7 100 µL

CHST11 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Ept1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4005106 1.0 µg DNA

Ept1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Defensin beta 2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-4307R-BF488 100 µL

Defensin beta 2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Olfr1222 CRISPR Activation Plasmid (m2)
sc-434383-ACT-2 20 µg

Olfr1222 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
F2RL1 Antibody (HRP)
orb52536-01 50 µg

F2RL1 Antibody (HRP)

Sign In for Pricing
View Details