Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF

Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.

Product Specifications

Synonyms

Fgfb, bFGF, FGF-basic

Gene Name

FGF2

UniProt

A0A287BGK8

Reactivity

Swine

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is <2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.1 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Mouse Fsh Polyclonal Antibody
CPBT-68049RM 50 µl*

Rabbit Anti Mouse Fsh Polyclonal Antibody

Sign In for Pricing
View Details
3- (5-Chloro-2-methoxyphenyl) prop-2-yn-1-ol
RVB04966-01 100 mg

3- (5-Chloro-2-methoxyphenyl) prop-2-yn-1-ol

Sign In for Pricing
View Details
3- (5-Chloro-2-methoxyphenyl) prop-2-yn-1-ol
RVB04966-02 1 g

3- (5-Chloro-2-methoxyphenyl) prop-2-yn-1-ol

Sign In for Pricing
View Details
Lentiviral human RMI1 shRNA (UAS) - Lentiviral human RMI1 shRNA (UAS) (25)
GTR15342560 1 Vial

Lentiviral human RMI1 shRNA (UAS) - Lentiviral human RMI1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Human RNH1 protein
MBS1561833-01 0.05 mg

Recombinant Human RNH1 protein

Sign In for Pricing
View Details
Recombinant Human RNH1 protein
MBS1561833-02 0.1 mg

Recombinant Human RNH1 protein

Sign In for Pricing
View Details