Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 9.8kDa protein containing 88 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays an key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.

Product Specifications

Gene Name

CXCL13

UniProt

A0A287A706

Reactivity

Swine

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 10.81 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-100 1x 100 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details