Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-17D (Interleukin-17D) protein, AF

Interleukin 17D (IL-17D) belongs to the IL-17 family of cytokines, predicts a molecular mass of 20 kDa. IL-17 family is closely linked to host defense and immune response, and IL-17D is a novel cytokine in the IL-17 family of cytokines that has not been extensively investigated. It is highly secreted by fibrosarcoma tumor cells; in addition, ectopic expression of IL-17D in tumor cells recruits natural killer cells via the CCL2 production of endothelial cells.

Product Specifications

Synonyms

AI462269

Gene Name

Il17d

UniProt

A0A0B4J1G4

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.74 kDa. The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAYCLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEPDKSAZDSANSSMDKLLLGPADRPAGR with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-2-(2-fluorophenyl)-1-cyclopropylethanone (90% purity)
TRC-B688795-5G 5 g

2-Bromo-2-(2-fluorophenyl)-1-cyclopropylethanone (90% purity)

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: left
CD563187 5 µg

Tissue Genomic DNA, Colon: left

Sign In for Pricing
View Details
TIMP2 (NM_003255) Human Recombinant Protein
TP309796L 1 mg

TIMP2 (NM_003255) Human Recombinant Protein

Sign In for Pricing
View Details
Band III (Q1/156), CF740 conjugate, 0.1mg/mL
BNC742826-500 1x 500 µL

Band III (Q1/156), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bik Recombinant Rabbit monoclonal Antibody
HA751413 100 µL

Bik Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ReadiLink™ iFluor® 647 Nick Translation dsDNA Labeling Kit
17405-AAT 20 Reactions

ReadiLink™ iFluor® 647 Nick Translation dsDNA Labeling Kit

Sign In for Pricing
View Details