Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDF-2/BMP-9, Human (His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. Animal-Free GDF-2/BMP-9 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-9/GDF-2 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDF-2/BMP-9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bmp-9-gdf-2-protein-human-his.html

Purity

98.0

Smiles

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Formula

2658 (Gene_ID) Q9UK05 (S320-R429) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus influenzae Oligopeptidase A (prlC), partial
MBS1190207 Inquire

Recombinant Haemophilus influenzae Oligopeptidase A (prlC), partial

Sign In for Pricing
View Details
ELISA Kit For Pituitary tumor-transforming gene 1 protein-interacting protein
E0521r 96 Tests

ELISA Kit For Pituitary tumor-transforming gene 1 protein-interacting protein

Sign In for Pricing
View Details
Rabbit Polyclonal BTBD16 Antibody
NBP2-14507-25ul 25 µL

Rabbit Polyclonal BTBD16 Antibody

Sign In for Pricing
View Details
IL11RA1 siRNA (Rat)
CRR3576-01 15 nmol

IL11RA1 siRNA (Rat)

Sign In for Pricing
View Details
IL11RA1 siRNA (Rat)
CRR3576-02 30 nmol

IL11RA1 siRNA (Rat)

Sign In for Pricing
View Details
SEMA6C ELISA Kit (Mouse)
OKEH05187-96W 96 Well

SEMA6C ELISA Kit (Mouse)

Sign In for Pricing
View Details