Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Product Specifications

Synonyms

SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9

Reactivity

Mouse

Source

E. coli

Endotoxin

Less than 1 EU/μg protein as determined by LAL method.

Form

Lyophilized

Storage Conditions

The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Calculated Molecular Weight

13.2KD

AA Sequence

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Contents

Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-100 1x 100 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (BRA-11G), CF647 conjugate, 0.1mg/mL
BNC470174-100 1x 100 µL

CD45RB (BRA-11G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details