Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Product Specifications

Synonyms

SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9

Reactivity

Mouse

Source

E. coli

Endotoxin

Less than 1 EU/μg protein as determined by LAL method.

Form

Lyophilized

Storage Conditions

The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Calculated Molecular Weight

13.2KD

AA Sequence

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Contents

Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr122 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV634751 1.0 µg DNA

Olr122 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
KRT5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1165505 3x 1.0 µg

KRT5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Uqcrc1 Mouse shRNA Lentiviral Particle (Locus ID 22273)
TL510441V 500 µL Each

Uqcrc1 Mouse shRNA Lentiviral Particle (Locus ID 22273)

Sign In for Pricing
View Details
MGLL Protein Vector (Mouse) (pPM-C-HA)
28553024 500 ng

MGLL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Gm4763 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
22036064 1.0 µg DNA

Gm4763 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mmu-miR-1981-5p miRNA Antagomir
orb1913066-01 10 nmol

Mmu-miR-1981-5p miRNA Antagomir

Sign In for Pricing
View Details