SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.
Product Specifications
Synonyms
SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8, Nonstructural Protein 8
Reactivity
Mouse
Source
E. coli
Endotoxin
Less than 1 EU/μg protein as determined by LAL method.
Form
Lyophilized
Storage Conditions
The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular Weight
22.7KD
AA Sequence
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Contents
Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS072685-01 48 Well
Rat A Disintegrin and Metalloprotease 15 ELISA Kit
Sign In for Pricing
View Details MBS072685-02 96 Well
Rat A Disintegrin and Metalloprotease 15 ELISA Kit
Sign In for Pricing
View Details MBS072685-03 5x 96 Well
Rat A Disintegrin and Metalloprotease 15 ELISA Kit
Sign In for Pricing
View Details MBS072685-04 10x 96 Well
Rat A Disintegrin and Metalloprotease 15 ELISA Kit
Sign In for Pricing
View Details 253332 100 µg
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM)
Sign In for Pricing
View Details 
abx513177 96 Tests
Rat Pituitary tumor-transforming gene 1 protein-interacting protein (PTTG1IP) ELISA Kit
Sign In for Pricing
View Details