Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX7, Human (HEK293, Fc)

GPX7, a protein with catalase activity, is predicted to respond to oxidative stress. It is located in the endoplasmic reticulum and is expressed in various tissues, including placenta (RPKM 15.6) and thyroid (RPKM 9.2) . This highlights the potential importance of GPX7 in antioxidative processes throughout the body. GPX7 Protein, Human (HEK293, Fc) is the recombinant human-derived GPX7 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GPX7 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gpx7-protein-human-hek293-fc.html

Purity

95.0

Smiles

QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Molecular Formula

2882 (Gene_ID) Q96SL4/NP_056511.2 (Q20-L187) (Accession)

Molecular Weight

Approximately 47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Antibody / EGF Receptor
V5390-100UG 100 µg

EGFR Antibody / EGF Receptor

Sign In for Pricing
View Details
NME7 Antibody
CSB-PA897289LA01HU-01 50 µg

NME7 Antibody

Sign In for Pricing
View Details
NME7 Antibody
CSB-PA897289LA01HU-02 100 µg

NME7 Antibody

Sign In for Pricing
View Details
OR5B12 Rabbit Polyclonal Antibody (HRP)
orb2085575 100 µL

OR5B12 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TMEFF1 Human Gene Knockout Kit (CRISPR)
KN407212 1 Kit

TMEFF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cables1 Mouse Gene Knockout Kit (CRISPR)
KN502402 1 Kit

Cables1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details