Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6C3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1526503 1.0 µg DNA

OR6C3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Gtse1 shRNA (UAS) - Lentiviral mouse Gtse1 shRNA (UAS, GFP) (100)
GTR15185073 1 Vial

Lentiviral mouse Gtse1 shRNA (UAS) - Lentiviral mouse Gtse1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
galectin-4 CRISPR Activation Plasmid (h2)
sc-404255-ACT-2 20 µg

galectin-4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Slco6c1 Mouse shRNA Plasmid (Locus ID 74441)
TL504986 1 Kit

Slco6c1 Mouse shRNA Plasmid (Locus ID 74441)

Sign In for Pricing
View Details
MITF Polyclonal Antibody
MBS2519132-01 0.02 mL

MITF Polyclonal Antibody

Sign In for Pricing
View Details
MITF Polyclonal Antibody
MBS2519132-02 0.06 mL

MITF Polyclonal Antibody

Sign In for Pricing
View Details