Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R8 antibody
70R-4732 50 ug

PPP1R8 antibody

Sign In for Pricing
View Details
Apatinib 5mg
A17249-5 5 mg

Apatinib 5mg

Sign In for Pricing
View Details
Human hsa-miR-4639-5p miRNA Agomir
abx881431-01 5 nmol

Human hsa-miR-4639-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-4639-5p miRNA Agomir
abx881431-02 10 nmol

Human hsa-miR-4639-5p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt), partial
MBS7097084 Inquire

Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt), partial

Sign In for Pricing
View Details
FASTKD2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6775R-BF405 100 µL

FASTKD2 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details