Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRELD1 MAb (Clone 842314)
MAB3128-SP 25 µg

Human CRELD1 MAb (Clone 842314)

Sign In for Pricing
View Details
Rabbit Polyclonal MAGEA10 Antibody [Alexa Fluor 700]
NBP3-06272AF700 0.1 mL

Rabbit Polyclonal MAGEA10 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Zfp260 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4586603 1.0 µg DNA

Zfp260 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Olfr544 CRISPR Activation Plasmid (m)
sc-434293-ACT 20 µg

Olfr544 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Slc25a41 shRNA (UAS) - Lentiviral mouse Slc25a41 shRNA (UAS) plasmid
GTR15251539 1 Vial

Lentiviral mouse Slc25a41 shRNA (UAS) - Lentiviral mouse Slc25a41 shRNA (UAS) plasmid

Sign In for Pricing
View Details
[6, 7- Bis (carboxymethoxy) coumarin- 4- yl]methyl- 8- bromoadenosine- 3', 5'- cyclic monophosphate (BCMCM-caged 8-Br-cAMP)
B 018-001 0.1 µmol ~ 76 µg

[6, 7- Bis (carboxymethoxy) coumarin- 4- yl]methyl- 8- bromoadenosine- 3', 5'- cyclic monophosphate (BCMCM-caged 8-Br-cAMP)

Sign In for Pricing
View Details