Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ClearBand 1M Tris, pH 7.4, 5x500 ml
T74055 5x 500 mL

ClearBand 1M Tris, pH 7.4, 5x500 ml

Sign In for Pricing
View Details
Anti-Phospho-Chk2 (T68) antibody
STJ90225 200 µl

Anti-Phospho-Chk2 (T68) antibody

Sign In for Pricing
View Details
CYLN2 (CLIP2) (NM_003388) Human Tagged Lenti ORF Clone
RC224491L4 10 µg

CYLN2 (CLIP2) (NM_003388) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DCTD Protein Vector (Rat) (pPB-C-His)
PV263310 500 ng

DCTD Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
TRAPPC5 (NM_001042462) Human Tagged Lenti ORF Clone
RC215878L4 10 µg

TRAPPC5 (NM_001042462) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZFYVE28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2676305 3x 1.0 µg

ZFYVE28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details