Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Estrone (Estrone) ELISA
KLU0263 1x 96 Well

GENLISA Estrone (Estrone) ELISA

Sign In for Pricing
View Details
anti-GNG8
YF-PA26801 50 ul

anti-GNG8

Sign In for Pricing
View Details
Anti-PON1 Polyclonal Antibody
PHD73101 100 μg

Anti-PON1 Polyclonal Antibody

Sign In for Pricing
View Details
Pig Endothelin 1 (EDN1) CLIA Kit
abx490134-01 96 Tests

Pig Endothelin 1 (EDN1) CLIA Kit

Sign In for Pricing
View Details
Pig Endothelin 1 (EDN1) CLIA Kit
abx490134-02 5x 96 Tests

Pig Endothelin 1 (EDN1) CLIA Kit

Sign In for Pricing
View Details
Pig Endothelin 1 (EDN1) CLIA Kit
abx490134-03 10x 96 Tests

Pig Endothelin 1 (EDN1) CLIA Kit

Sign In for Pricing
View Details