Cathepsin H, Mouse (HEK293, His)
Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].
Product Specifications
Product Name Alternative
Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html
Purity
95.00
Smiles
AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV
Molecular Formula
13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)
Molecular Weight
Approximately 42 kDa
References & Citations
[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]](https://cdn.genprice.uk/products/937/6868c385994c49e6dc3f933f/imageurl/ta800125am.webp)
TA800125AM 100 µL
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
Sign In for Pricing
View Details ![Mouse Monoclonal Proliferation Marker Antibody (JC1) [PerCP]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-50256PCP 0.1 mL
Mouse Monoclonal Proliferation Marker Antibody (JC1) [PerCP]
Sign In for Pricing
View Details 
224181-01 50 µL
MICA (HLA class I Antigen, FLJ36918, FLJ60820, MGC111087, MGC21250, MHC class I Chain Related Gene A Protein, MHC class I Chain Related Protein A, MHC class I Chain Related Protein A HLA B HLA C, MHC class I Polypeptide Related Sequence A, MHC class I Polypeptide-Related Sequence A, MHC class I Related Protein, MIC A, MIC-A, micA, MICA, OTTHUMP00000029088, OTTHUMP00000044528, OTTHUMP00000165170, OTTHUMP00000165172, PERB11.1, Stress inducible class I Homolog) discontinued
Sign In for Pricing
View Details