Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella sonnei Cell volume regulation protein A (cvrA), partial
MBS7080365 Inquire

Recombinant Shigella sonnei Cell volume regulation protein A (cvrA), partial

Sign In for Pricing
View Details
Mouse Rims3 qPCR Primer Pair
QM63138S 200 Tests

Mouse Rims3 qPCR Primer Pair

Sign In for Pricing
View Details
POK5 rabbit pAb
UB-GEN-7961 100 µL

POK5 rabbit pAb

Sign In for Pricing
View Details
RHOA (ARH12, ARHA, RHO12, RHOH12, Aplysia ras-related Homolog 12, Oncogene RHO H12, Small GTP Binding Protein RhoA) (MaxLight 550)
207863-ML550 100 µL

RHOA (ARH12, ARHA, RHO12, RHOH12, Aplysia ras-related Homolog 12, Oncogene RHO H12, Small GTP Binding Protein RhoA) (MaxLight 550)

Sign In for Pricing
View Details
GPR137 3'UTR Luciferase Stable Cell Line
TU009220 1.0 mL

GPR137 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human FAH (Fumarylacetoacetate Hydrolase) ELISA Kit
EH24427 96 Tests

Human FAH (Fumarylacetoacetate Hydrolase) ELISA Kit

Sign In for Pricing
View Details