Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEDF (Cell Proliferation-inducing Gene 35 Protein, EPC 1, EPC-1, EPC1, PEDF, PEDF, PIG 35, PIG35, Pigment epithelium derived Factor, Pigment epithelium-derived Factor, Proliferation inducing Protein 35, Serpin F1, Serpin peptidase Inhibitor clade F Member 1, SERPINF 1, Serpinf1) discontinued
224956-01 50 µL

PEDF (Cell Proliferation-inducing Gene 35 Protein, EPC 1, EPC-1, EPC1, PEDF, PEDF, PIG 35, PIG35, Pigment epithelium derived Factor, Pigment epithelium-derived Factor, Proliferation inducing Protein 35, Serpin F1, Serpin peptidase Inhibitor clade F Member 1, SERPINF 1, Serpinf1) discontinued

Sign In for Pricing
View Details
PEDF (Cell Proliferation-inducing Gene 35 Protein, EPC 1, EPC-1, EPC1, PEDF, PEDF, PIG 35, PIG35, Pigment epithelium derived Factor, Pigment epithelium-derived Factor, Proliferation inducing Protein 35, Serpin F1, Serpin peptidase Inhibitor clade F Member 1, SERPINF 1, Serpinf1) discontinued
224956-02 100 µL

PEDF (Cell Proliferation-inducing Gene 35 Protein, EPC 1, EPC-1, EPC1, PEDF, PEDF, PIG 35, PIG35, Pigment epithelium derived Factor, Pigment epithelium-derived Factor, Proliferation inducing Protein 35, Serpin F1, Serpin peptidase Inhibitor clade F Member 1, SERPINF 1, Serpinf1) discontinued

Sign In for Pricing
View Details
STON1 Antibody
A19301-100UG 100 µg

STON1 Antibody

Sign In for Pricing
View Details
COG3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0481003 1.0 µg DNA

COG3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CORD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0491105 3x 1.0 µg

CORD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human LAL ELISA Kit
E108835 1 Each

Human LAL ELISA Kit

Sign In for Pricing
View Details