Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Mouse Monoclonal Antibody [Clone ID: OTI5C2]
TA802067 100 µL

CD4 Mouse Monoclonal Antibody [Clone ID: OTI5C2]

Sign In for Pricing
View Details
Human TRIM44 Recombinant Protein
PPT-15830 100 µg

Human TRIM44 Recombinant Protein

Sign In for Pricing
View Details
Lysozyme (LYZ) Mouse Monoclonal Antibody [Clone ID: 06/961]
BM584 200 µg

Lysozyme (LYZ) Mouse Monoclonal Antibody [Clone ID: 06/961]

Sign In for Pricing
View Details
Mesotrione
466007 100.0mg

Mesotrione

Sign In for Pricing
View Details
pGreenFire1-Notch (plasmid)+ EF1-Puro
TR020PA-P 10 µg

pGreenFire1-Notch (plasmid)+ EF1-Puro

Sign In for Pricing
View Details
Coagulation Factor VIII B Polypeptide (F13B) Mouse ELISA Kit
D3083 96 Tests

Coagulation Factor VIII B Polypeptide (F13B) Mouse ELISA Kit

Sign In for Pricing
View Details