Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREX1 (Three Prime Repair Exonuclease 1, 3'-5' Exonuclease TREX1, AGS1, CRV, DNase III, DRN3, HERNS) (MaxLight 405)
MBS6397132-01 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, 3'-5' Exonuclease TREX1, AGS1, CRV, DNase III, DRN3, HERNS) (MaxLight 405)

Sign In for Pricing
View Details
TREX1 (Three Prime Repair Exonuclease 1, 3'-5' Exonuclease TREX1, AGS1, CRV, DNase III, DRN3, HERNS) (MaxLight 405)
MBS6397132-02 5x 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, 3'-5' Exonuclease TREX1, AGS1, CRV, DNase III, DRN3, HERNS) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)
MBS1369574-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)
MBS1369574-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)
MBS1369574-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)
MBS1369574-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0051 protein SE_0610 (SE_0610)

Sign In for Pricing
View Details