Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG6 Human siRNA Oligo Duplex (Locus ID 59285)
SR324800 1 Kit

CACNG6 Human siRNA Oligo Duplex (Locus ID 59285)

Sign In for Pricing
View Details
Rabbit Polyclonal ACBP Antibody
NBP2-97012-100ul 100 µL

Rabbit Polyclonal ACBP Antibody

Sign In for Pricing
View Details
SIRPG Antibody
ABD4508 100 µg

SIRPG Antibody

Sign In for Pricing
View Details
Mouse PHOSPHO1 shRNA Plasmid
abx982317-01 150 µg

Mouse PHOSPHO1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PHOSPHO1 shRNA Plasmid
abx982317-02 300 µg

Mouse PHOSPHO1 shRNA Plasmid

Sign In for Pricing
View Details
UMPS Polyclonal Antibody
E55A02823 100 µg

UMPS Polyclonal Antibody

Sign In for Pricing
View Details