Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NuMA (NUMA1) mouse monoclonal antibody, clone C02142, Azide Free
AM26526AF-N 100 µg

NuMA (NUMA1) mouse monoclonal antibody, clone C02142, Azide Free

Sign In for Pricing
View Details
Human MAGEA12 Pre-designed siRNA Set B
SI009105B 1 Each

Human MAGEA12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Col16a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3676508 1.0 µg DNA

Col16a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EphB3 (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (MaxLight 750)
MBS6232710-01 0.1 mL

EphB3 (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (MaxLight 750)

Sign In for Pricing
View Details
EphB3 (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (MaxLight 750)
MBS6232710-02 5x 0.1 mL

EphB3 (Ephrin Type-B receptor 3, Tyrosine-protein Kinase Receptor HEK-2, EPH-like Kinase 2, EK2, Tyrosine-protein Kinase TYRO6, ETK2, HEK2, TYRO6) (MaxLight 750)

Sign In for Pricing
View Details
PE Anti-Human/Mouse IL-5 Antibody[TRFK5]
E-AB-F1205UD-01 25 µg

PE Anti-Human/Mouse IL-5 Antibody[TRFK5]

Sign In for Pricing
View Details