Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIB Protein Vector (Mouse) (pPB-N-His)
PV216555 500 ng

PKIB Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Porcine Anti-Interleukin 21 ELISA Kit
MBS7274491-01 48 Well

Porcine Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Porcine Anti-Interleukin 21 ELISA Kit
MBS7274491-02 96 Well

Porcine Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Porcine Anti-Interleukin 21 ELISA Kit
MBS7274491-03 5x 96 Well

Porcine Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
Porcine Anti-Interleukin 21 ELISA Kit
MBS7274491-04 10x 96 Well

Porcine Anti-Interleukin 21 ELISA Kit

Sign In for Pricing
View Details
CECR6 Polyclonal Antibody, Cy3 Conjugated
bs-9006R-Cy3 100 µL

CECR6 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details