Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulin Antibody (YA1162, Rabbit)
HY-P81417-01 10 µL

Granulin Antibody (YA1162, Rabbit)

Sign In for Pricing
View Details
Granulin Antibody (YA1162, Rabbit)
HY-P81417-02 50 μL

Granulin Antibody (YA1162, Rabbit)

Sign In for Pricing
View Details
Granulin Antibody (YA1162, Rabbit)
HY-P81417-03 100 µL

Granulin Antibody (YA1162, Rabbit)

Sign In for Pricing
View Details
ITPKA 3'UTR GFP Stable Cell Line
TU061361 1.0 mL

ITPKA 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Luminescent ATP Detection Assay Kit (Enhanced)
K2043-200 200 Tests

Luminescent ATP Detection Assay Kit (Enhanced)

Sign In for Pricing
View Details
Phospho-alpha Synuclein (S129) Rabbit monoclonal antibody
BS40071-01 50 µL

Phospho-alpha Synuclein (S129) Rabbit monoclonal antibody

Sign In for Pricing
View Details