Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella canis Lipoprotein signal peptidase (lspA), partial
MBS7066204 Inquire

Recombinant Brucella canis Lipoprotein signal peptidase (lspA), partial

Sign In for Pricing
View Details
HEK293T-PLAUR Overexpressing Cell Line
RG-1154 5x 10^6

HEK293T-PLAUR Overexpressing Cell Line

Sign In for Pricing
View Details
Pcdhb10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6457006 1.0 µg DNA

Pcdhb10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Pygl sgRNA CRISPR Lentivector set (Rat)
K6942401 3x 1.0 µg

Pygl sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti-human DnaJ homolog subfamily B member 2 polyclonal Antibody
MBS7001000-01 0.05 mg

Rabbit anti-human DnaJ homolog subfamily B member 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DnaJ homolog subfamily B member 2 polyclonal Antibody
MBS7001000-02 0.1 mg

Rabbit anti-human DnaJ homolog subfamily B member 2 polyclonal Antibody

Sign In for Pricing
View Details