Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP1 (NM_001017416) Human Over-expression Lysate
LC422785 20 µg

USP1 (NM_001017416) Human Over-expression Lysate

Sign In for Pricing
View Details
PcDNA3.1-GRIA1
BZ0920-1 1 Vial

PcDNA3.1-GRIA1

Sign In for Pricing
View Details
Neuropeptide Q Rabbit pAb
E47R19221 100 µL

Neuropeptide Q Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Serpin E2/PN1 Antibody (OTI2C9) [Alexa Fluor 350]
NBP2-74117AF350 0.1 mL

Mouse Monoclonal Serpin E2/PN1 Antibody (OTI2C9) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans ZK686.5 Protein (aa 1-202)
VAng-Ly3983-500gEcoli 500 µg (E. coli)

Recombinant Caenorhabditis Elegans ZK686.5 Protein (aa 1-202)

Sign In for Pricing
View Details
TAPT1 CRISPR Knock Out 293T Cell Line (Human)
46122141 1x 10^6 Cells / 1.0 mL

TAPT1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details