Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin H, Mouse (HEK293, His)

Cathepsin H Protein, Mouse (HEK293, His) is an approximately 36-40 kDa cathepsin H protein with a His-flag. Cathepsin H is a lysosomal cysteine protease of the papain family[1].

Product Specifications

Product Name Alternative

Cathepsin H Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-h-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

Molecular Formula

13036 (Gene_ID) AAA82966.1 (A21-V333) (Accession)

Molecular Weight

Approximately 42 kDa

References & Citations

[1]M Söderström, et al. Cathepsin expression during skeletal development. Biochim Biophys Acta. 1999 Jul 7;1446 (1-2) :35-46.|[2]W P Lafuse, et al. IFN-gamma increases cathepsin H mRNA levels in mouse macrophages. J Leukoc Biol. 1995 Apr;57 (4) :663-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAL1 (phospho Ser122) Rabbit Polyclonal Antibody
APRab05520-01 20 µL

TAL1 (phospho Ser122) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAL1 (phospho Ser122) Rabbit Polyclonal Antibody
APRab05520-02 50 µL

TAL1 (phospho Ser122) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAL1 (phospho Ser122) Rabbit Polyclonal Antibody
APRab05520-03 100 µL

TAL1 (phospho Ser122) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAL1 (phospho Ser122) Rabbit Polyclonal Antibody
APRab05520-04 200 µL

TAL1 (phospho Ser122) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYB5P1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
56076151 3x 1.0 µg DNA

CYB5P1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
NR1H4 Protein Vector (Rat) (pPM-C-HA)
PV285932 500 ng

NR1H4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details