Recombinant Apis mellifera Defensin-1
Product Specifications
Product Name Alternative
(Royalisin)
Abbreviation
Recombinant Apis mellifera Defensin-1 protein
UniProt
P17722
Expression Region
44-94aa
Organism
Apis mellifera (Honeybee)
Target Sequence
VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF
Tag
N-terminal 10xHis-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Relevance
Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
11.6 kDa
References & Citations
"Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera." Klaudiny J., Albert S., Bachanova K., Kopernicky J., Simuth J. Insect Biochem. Mol. Biol. 35:11-22 (2005)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742152-100 1x 100 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PROCR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E11]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1ca2f/imageurl/ta805523am.webp)
TA805523AM 100 µL
PROCR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E11]
Sign In for Pricing
View Details 
BNC882287-500 1x 500 µL
SOX9 / SRY-box 9 (SOX9/2287R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-H0073-01 5x 96 Tests
Uncoated Human OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0073-02 15x 96 Tests
Uncoated Human OxLDL (Oxidized Low Density Lipoprotein) ELISA Kit
Sign In for Pricing
View Details