Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Defensin-1

Product Specifications

Product Name Alternative

(Royalisin)

Abbreviation

Recombinant Apis mellifera Defensin-1 protein

UniProt

P17722

Expression Region

44-94aa

Organism

Apis mellifera (Honeybee)

Target Sequence

VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.6 kDa

References & Citations

"Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera." Klaudiny J., Albert S., Bachanova K., Kopernicky J., Simuth J. Insect Biochem. Mol. Biol. 35:11-22 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EFNB1 Protein, His Tag
E40KMH1010 20 µg

Recombinant Human EFNB1 Protein, His Tag

Sign In for Pricing
View Details
PLV2-CMV-ROCK1 (human) -3xHA-Puro
BZ52701 1 Vial

PLV2-CMV-ROCK1 (human) -3xHA-Puro

Sign In for Pricing
View Details
RNF6 siRNA (Mouse)
MBS8240475-01 15 nmol

RNF6 siRNA (Mouse)

Sign In for Pricing
View Details
RNF6 siRNA (Mouse)
MBS8240475-02 30 nmol

RNF6 siRNA (Mouse)

Sign In for Pricing
View Details
RNF6 siRNA (Mouse)
MBS8240475-03 5x 30 nmol

RNF6 siRNA (Mouse)

Sign In for Pricing
View Details
HIPK2 Rabbit Polyclonal Antibody
TA330617 100 µL

HIPK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details