Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)

Product Specifications

Product Name Alternative

Ns12.7;12.7 kDa accessory protein

Abbreviation

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa

Gene Name

5a

UniProt

Q8V434

Expression Region

1-109aa

Organism

Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Target Sequence

MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVHG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein & Coronavirus Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-02 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-04 0.1 mg (Yeast)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)
MBS1057165-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O7:K1 Cytidine deaminase (cdd)

Sign In for Pricing
View Details