Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)

Product Specifications

Product Name Alternative

Ns12.7;12.7 kDa accessory protein

Abbreviation

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa

Gene Name

5a

UniProt

Q8V434

Expression Region

1-109aa

Organism

Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Target Sequence

MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVHG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein & Coronavirus Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TCN1 Knockout A549 cell line
GTR15419250 1 Vial

Human TCN1 Knockout A549 cell line

Sign In for Pricing
View Details
Hyaluronidase3 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5889R-BF405 100 µL

Hyaluronidase3 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal NRBF2 Antibody [Janelia Fluor 646]
NBP1-00109JF646 0.1 mL

Rabbit Polyclonal NRBF2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8962R) [PE]
NBP3-24221PE 0.1 mL

Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8962R) [PE]

Sign In for Pricing
View Details
Equine IL-1ra/IL-1F3 Biotinylated Affinity Purified PAb
BAF2466 50 µg

Equine IL-1ra/IL-1F3 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
PNPG (Gus)
N-325-5-10g 10 g

PNPG (Gus)

Sign In for Pricing
View Details