Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-SARS-CoV-2 NSP9 Antibody Fluoro550 Conjugated

Product Specifications

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19) . Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Synonyms

Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp9; Non-structural protein 9

Gene Name

Rep

Gene ID

43740578

UniProt

P0DTC1/P0DTD1

Host

Rabbit

Reactivity

Human

Immunogen

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Clonality

Polyclonal

Tissue Specificity

Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .

Applications

Flow Cytometry

Field of Research

Protein Phosphorylation, Ser/Thr Kinases, Signal Transduction

Purification

Immunogen affinity purified.

Form

Liquid

Function

Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.

References & Citations

1. Benedetti F, et al. J Transl Med, 2020 Aug 31. 2. Douangamath A, et al. Nat Commun, 2020 Oct 7. 3. Krafcikova P, et al. Nat Commun, 2020 Jul 24. 4. Rosas-Lemus M, et al. Sci Signal, 2020 Sep 29. 5. Vuong W, et al. Nat Commun, 2020 Aug 27.

Storage Conditions

At -20 ̊C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Calculated Molecular Weight

16693 MW

Applications Notes

6

Gene Name Synonym

Non-structural protein 9

Subcellular Location

Cytoplasm .

Protein Name

Synapsin-1

Isotype

Rabbit IgG

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ULBP-2 His-tag Avi-tag Protein CF
AVI10538-050 50 µg

Recombinant Human ULBP-2 His-tag Avi-tag Protein CF

Sign In for Pricing
View Details
CFD Polyclonal Antibody
E-AB-68417-01 60 µL

CFD Polyclonal Antibody

Sign In for Pricing
View Details
CFD Polyclonal Antibody
E-AB-68417-02 120 µL

CFD Polyclonal Antibody

Sign In for Pricing
View Details
CFD Polyclonal Antibody
E-AB-68417-03 200 µL

CFD Polyclonal Antibody

Sign In for Pricing
View Details
Human COG4 siRNA
abx912374-01 15 nmol

Human COG4 siRNA

Sign In for Pricing
View Details
Human COG4 siRNA
abx912374-02 30 nmol

Human COG4 siRNA

Sign In for Pricing
View Details