Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuroserpin, Mouse (HEK293, His)

Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Neuroserpin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuroserpin-protein-mouse-hek293-his.html

Purity

98.0

Smiles

TGATFPDETITEWSVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKSCIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPETMNTSGHDFEEL

Molecular Formula

20713 (Gene_ID) O35684 (T17-L410) (Accession)

Molecular Weight

Approximately 45-58 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL
BNC682149-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
BNC400718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details