Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to DCUN1D4

Product Specifications

Product Name Alternative

DCNL4

UniProt

Q92564

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DCUN1D4

Target

DCUN1D4

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL

Field of Research

Epigenetics

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

34kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035492

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAX4 Antibody Picoband® Fluoro550 Conjugated
A03165-2-Fluoro550 100 µg/Vial

Anti-PAX4 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Eloa shRNA (UAS) - Lentiviral mouse Eloa shRNA (UAS, GFP) (100)
GTR15302556 1 Vial

Lentiviral mouse Eloa shRNA (UAS) - Lentiviral mouse Eloa shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MagWash® System for Two, 25mL or 50mL SpinVessels® (in a 1x2 array), the First Position has a Large Magnet to Produce a 50mm by 10.5mm Pellet Along One Side of the SpinVessel® that is 9.8mm Above the Bottom of the SpinVessel® for Safe Pipetting, Designed for High-Volume Separation (up to 50mL), the Second Position has Four NdFeB Magnets Under the Drive Base to Produce Four Pellets10mm in Diameter, 3.5mm Above the Bottom of the SpinVessel® for Safe Pipetting, Designed for Low-Volume Separation (less than 25mL), the Motor Box has SLAS Dimensions, Direct Drive Stepper Motor, Aluminum Enclosure, and is Computer Controlled via ASCII Commands, 100/240 Volts, 50/60 Hz, CE Compliant, US Patent Pending, European Patent #3887049, Sweden Patent #19889987.4
VP 418MW2-2-50HL-CC 1 EACH

MagWash® System for Two, 25mL or 50mL SpinVessels® (in a 1x2 array), the First Position has a Large Magnet to Produce a 50mm by 10.5mm Pellet Along One Side of the SpinVessel® that is 9.8mm Above the Bottom of the SpinVessel® for Safe Pipetting, Designed for High-Volume Separation (up to 50mL), the Second Position has Four NdFeB Magnets Under the Drive Base to Produce Four Pellets10mm in Diameter, 3.5mm Above the Bottom of the SpinVessel® for Safe Pipetting, Designed for Low-Volume Separation (less than 25mL), the Motor Box has SLAS Dimensions, Direct Drive Stepper Motor, Aluminum Enclosure, and is Computer Controlled via ASCII Commands, 100/240 Volts, 50/60 Hz, CE Compliant, US Patent Pending, European Patent #3887049, Sweden Patent #19889987.4

Sign In for Pricing
View Details
AQ-13 dihydrochloride (Standard)
HY-100358R 1 Each

AQ-13 dihydrochloride (Standard)

Sign In for Pricing
View Details
ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (MaxLight 650) discontinued
A0660-02A-ML650 100 µL

ACO2, ID (Aconitate Hydratase, Mitochondrial, Citrate Hydro-lyase, Aconitase) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Phospho-p53 (Ser37) Peptide
AF3748-BP 1 mg

Phospho-p53 (Ser37) Peptide

Sign In for Pricing
View Details