Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline Bicarbonate (80% in water)
TRC-C274250-500MG 500 mg

Choline Bicarbonate (80% in water)

Sign In for Pricing
View Details
SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2) (MaxLight 405)
MBS6192530-01 0.1 mL

SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2) (MaxLight 405)

Sign In for Pricing
View Details
SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2) (MaxLight 405)
MBS6192530-02 5x 0.1 mL

SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Monoclonal CESK1 Antibody (OTI2A5) [DyLight 550]
NBP2-72413R 0.1 mL

Mouse Monoclonal CESK1 Antibody (OTI2A5) [DyLight 550]

Sign In for Pricing
View Details
Recombinant Human LENG1 Protein - (Dry Ice)
H00079165-P01-25ug 25 µg

Recombinant Human LENG1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Psmb8 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6921503 1.0 µg DNA

Psmb8 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details