Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus Monkey ANGPTL7 (XP_005544861.1) VersaClone cDNA
RDC3392 10 µg

Cynomolgus Monkey ANGPTL7 (XP_005544861.1) VersaClone cDNA

Sign In for Pricing
View Details
Recombinant Mouse Notch-2 Fc Chimera CF
5196-NT-050 50 µg

Recombinant Mouse Notch-2 Fc Chimera CF

Sign In for Pricing
View Details
MTND1P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV734699 1.0 µg DNA

MTND1P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
UBE2W (NM_001271015) Human Tagged ORF Clone
RG232036 10 µg

UBE2W (NM_001271015) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse G protein-coupled receptor 124 (GPR124) ELISA Kit
EIA07781m 1 Kit

Mouse G protein-coupled receptor 124 (GPR124) ELISA Kit

Sign In for Pricing
View Details
Anti-Malonyl-Histone H3 (Lys122) Antibody (8H256)
MF-0080649-01 25 µL

Anti-Malonyl-Histone H3 (Lys122) Antibody (8H256)

Sign In for Pricing
View Details