Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ipcef1 shRNA (UAS) - Lentiviral mouse Ipcef1 shRNA (UAS, iRFP) (25)
GTR15246746 1 Vial

Lentiviral mouse Ipcef1 shRNA (UAS) - Lentiviral mouse Ipcef1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mbp (NM_001025294) Rat Untagged Clone
RN200506 10 µg

Mbp (NM_001025294) Rat Untagged Clone

Sign In for Pricing
View Details
MRPS18B Protein Vector (Rat) (pPB-C-His)
PV283246 500 ng

MRPS18B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Galnt4 3'UTR Luciferase Stable Cell Line
TU106887 1.0 mL

Galnt4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Benzyl 2-(Benzyloxy)-3-bromobenzoate
TRC-B231460-100MG 100 mg

Benzyl 2-(Benzyloxy)-3-bromobenzoate

Sign In for Pricing
View Details
Faropenem Impurity 77
RM-F181677-01 10 mg

Faropenem Impurity 77

Sign In for Pricing
View Details