Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Petrii Bpet4097 Protein (aa 1-252)
VAng-Lsx4722-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Petrii Bpet4097 Protein (aa 1-252)

Sign In for Pricing
View Details
FNDC5 (NM_153756) Human Over-expression Lysate
LS252995-20ug 20 µg

FNDC5 (NM_153756) Human Over-expression Lysate

Sign In for Pricing
View Details
ALPL Protein Vector (Human) (pPB-N-His)
PV048778 500 ng

ALPL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRRSP22 Polyclonal Antibody
MBS9012791 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CRRSP22 Polyclonal Antibody

Sign In for Pricing
View Details
DDX39B Polyclonal Antibody
MBS2542903-01 0.02 mL

DDX39B Polyclonal Antibody

Sign In for Pricing
View Details
DDX39B Polyclonal Antibody
MBS2542903-02 0.06 mL

DDX39B Polyclonal Antibody

Sign In for Pricing
View Details