Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ano1 3'UTR Luciferase Stable Cell Line
TU101863 1.0 mL

Ano1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
pHAGE-TO-dCas9 Plasmid
PVT23500 2 µg

pHAGE-TO-dCas9 Plasmid

Sign In for Pricing
View Details
RPS2P25 sgRNA CRISPR Lentivector (Human) (Target 2)
K2001503 1.0 µg DNA

RPS2P25 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human ABCC4 Protein, N-His
E55P0272 50 µg

Recombinant Human ABCC4 Protein, N-His

Sign In for Pricing
View Details
RNF186 Peptide
DF15951-BP 1 mg

RNF186 Peptide

Sign In for Pricing
View Details
Lentiviral human SFXN4 shRNA (UAS) - Lentiviral human SFXN4 shRNA (UAS, iRFP) plasmid
GTR15332815 1 Vial

Lentiviral human SFXN4 shRNA (UAS) - Lentiviral human SFXN4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details