Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Follistatin
546963 200 µL

Follistatin

Sign In for Pricing
View Details
HSD3B1 Protein Vector (Mouse) (pPM-C-His)
PV190013 500 ng

HSD3B1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Polyclonal TSC1 Antibody
APR00235G 0.1mg

Polyclonal TSC1 Antibody

Sign In for Pricing
View Details
MPHOSPH8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV700582 1.0 µg DNA

MPHOSPH8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3050002 1.0 µg DNA

Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Gnmt Mouse siRNA Oligo Duplex (Locus ID 14711)
SR408461 1 Kit

Gnmt Mouse siRNA Oligo Duplex (Locus ID 14711)

Sign In for Pricing
View Details