Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD6 (A2) polyclonal antibody
BS1038-01 50 µL

CARD6 (A2) polyclonal antibody

Sign In for Pricing
View Details
CARD6 (A2) polyclonal antibody
BS1038-02 100 µL

CARD6 (A2) polyclonal antibody

Sign In for Pricing
View Details
SH2D5, ID (SH2D5, SH2 domain-containing protein 5) (Biotin) discontinued
041685-Biotin 200 µL

SH2D5, ID (SH2D5, SH2 domain-containing protein 5) (Biotin) discontinued

Sign In for Pricing
View Details
Human LTA4H Protein, His Tag
KMPH6389-01 10 µg

Human LTA4H Protein, His Tag

Sign In for Pricing
View Details
Human LTA4H Protein, His Tag
KMPH6389-02 20 µg

Human LTA4H Protein, His Tag

Sign In for Pricing
View Details
GPR142 Rabbit Polyclonal Antibody
TA331328 100 µL

GPR142 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details