Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARHGEF33 Antibody
NBP2-58937-25ul 25 µL

Rabbit Polyclonal ARHGEF33 Antibody

Sign In for Pricing
View Details
CR2 Protein Vector (Rat) (pPM-C-His)
PV261613 500 ng

CR2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human NFAT5 sgRNA gene knockout kit - Lentiviral human NFAT5 sgRNA gene knockout kit (plasmid)
GTR15401348 1 Vial

Lentiviral human NFAT5 sgRNA gene knockout kit - Lentiviral human NFAT5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rabbit Monoclonal HIF-1 alpha Antibody (2443C) [Janelia Fluor 635]
NBP2-75978JF635 0.1 mL

Rabbit Monoclonal HIF-1 alpha Antibody (2443C) [Janelia Fluor 635]

Sign In for Pricing
View Details
HSD3B1 (NM_000862) Human Tagged ORF Clone Lentiviral Particle
RC204497L3V 200 µL

HSD3B1 (NM_000862) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) CytoSection
TS416588P5 25 Slides

HNF 4 alpha (HNF4A) CytoSection

Sign In for Pricing
View Details