Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2/MISRII, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AMHR2/MISRII Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/amhr2-misrii-protein-mouse-hek293-his.html

Purity

95.0

Smiles

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

Molecular Formula

110542 (Gene_ID) Q8K592 (Q16-M147) (Accession)

Molecular Weight

Approximately 25 kDa & 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc2a3 Mouse Pre-designed siRNA Set A
HY-RS13168 1 Set

Slc2a3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-CD20 antibody (1F2), IgG1 Chimeric mAb
MBS1882401-01 0.01 mg

Anti-CD20 antibody (1F2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-CD20 antibody (1F2), IgG1 Chimeric mAb
MBS1882401-02 0.1 mg

Anti-CD20 antibody (1F2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-CD20 antibody (1F2), IgG1 Chimeric mAb
MBS1882401-03 0.5 mg

Anti-CD20 antibody (1F2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Anti-CD20 antibody (1F2), IgG1 Chimeric mAb
MBS1882401-04 5x 0.5 mg

Anti-CD20 antibody (1F2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
ENTPD8, CT (ENTPD8, Ectonucleoside triphosphate diphosphohydrolase 8) (FITC)
MBS6295801-01 0.2 mL

ENTPD8, CT (ENTPD8, Ectonucleoside triphosphate diphosphohydrolase 8) (FITC)

Sign In for Pricing
View Details