Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Corticoliberin (Crh)

Product Specifications

Product Name Alternative

(Corticotropin-releasing factor) (CRF) (Corticotropin-releasing hormone)

Abbreviation

Recombinant Mouse Crh protein

Gene Name

Crh

UniProt

Q8CIT0

Expression Region

145-185aa

Organism

Mus musculus (Mouse)

Target Sequence

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.1 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-500 1x 500 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details