Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDUA, Human (His)

IDUA Protein, with catalytic activity, hydrolyzes unsulfated alpha-L-iduronosidic linkages in dermatan sulfate. Its enzymatic function is crucial in breaking down these specific bonds, contributing to the degradation of dermatan sulfate and maintaining cellular homeostasis. IDUA Protein, Human (His) is the recombinant human-derived IDUA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IDUA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/idua-protein-human-his.html

Purity

96

Smiles

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Molecular Formula

3425 (Gene_ID) P35475-1 (A28-P653) (Accession)

Molecular Weight

Approximately 71-73.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDA Recombinant Protein
32-2355-20 20 µg

GDA Recombinant Protein

Sign In for Pricing
View Details
NFKB2 | NFκB p100 Recombinant Rabbit mAb
orb3184943-01 25 µL

NFKB2 | NFκB p100 Recombinant Rabbit mAb

Sign In for Pricing
View Details
NFKB2 | NFκB p100 Recombinant Rabbit mAb
orb3184943-02 50 µL

NFKB2 | NFκB p100 Recombinant Rabbit mAb

Sign In for Pricing
View Details
NFKB2 | NFκB p100 Recombinant Rabbit mAb
orb3184943-03 100 µL

NFKB2 | NFκB p100 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Complement C3 beta antibody
10-1814 200 ul

Complement C3 beta antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TOP2B Antibody [Alexa Fluor 350]
NBP2-97789AF350 0.1 mL

Rabbit Polyclonal TOP2B Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details