Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAI-2, Human (HEK293, His)

HAI-2 protein is a multifunctional inhibitor that regulates multiple cellular processes by potently inhibiting HGFAC and reducing serine protease activity, specifically TMPRSS13 and ST14/matriptase. HAI-2 is good at inhibiting plasmin, plasma and tissue kallikrein, with broad-spectrum inhibitory capabilities. HAI-2 Protein, Human (HEK293, His) is the recombinant human-derived HAI-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HAI-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hai-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

Molecular Formula

10653 (Gene_ID) O43291-1 (A28-K197) (Accession)

Molecular Weight

24-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-04 1 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-05 5 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)
MBS2093783-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 2 (STAT2)

Sign In for Pricing
View Details