Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Canine

IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, and plays a key role in activating antibacterial, antiviral, and antitumor responses. Through the JAK-STAT pathway, its interaction with the receptor IFNGR1 triggers gene regulation. IFN-gamma Protein, Canine is the recombinant canine-derived IFN-gamma protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-canine.html

Purity

95.0

Smiles

QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Molecular Formula

403801 (Gene_ID) P42161 (Q24-K166) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8RB Rabbit Polyclonal Antibody (FITC)
orb2122914 100 µL

IL8RB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Endothelial Cells Rat Monoclonal Antibody [Clone ID: 1F10]
BM4057B 200 µg

Endothelial Cells Rat Monoclonal Antibody [Clone ID: 1F10]

Sign In for Pricing
View Details
Rat MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
E39ER0048 96 Tests

Rat MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit

Sign In for Pricing
View Details
TUSC5 Rabbit pAb, PerCP-Cy7 conjugated
orb2853201 100 µL

TUSC5 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
AcnB, E. coli
HY-P75559 1 Each

AcnB, E. coli

Sign In for Pricing
View Details
Rabbit S100 Calcium Binding Protein A8/Calgranulin A (S100A8) ELISA Kit
abx363365 96 Well

Rabbit S100 Calcium Binding Protein A8/Calgranulin A (S100A8) ELISA Kit

Sign In for Pricing
View Details