Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (177 a.a)

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (177 a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-177-a-a.html

Purity

96.95

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-1 (E67-T243) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nakayama F, et al. Fibroblast growth factor-12 (FGF12) translocation into intestinal epithelial cells is dependent on a novel cell-penetrating peptide domain: involvement of internalization in the in vivo role of exogenous FGF12. J Biol Chem. 2011 Jul 22;286 (29) :25823-34.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pigm (NM_026234) Mouse Tagged Lenti ORF Clone
MR216263L4 10 µg

Pigm (NM_026234) Mouse Tagged Lenti ORF Clone

Ask
View Details
RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 490)
132496-ML490 100 µL

RFC5 (Replication Factor C Subunit 5, Activator 1 Subunit 5, Replication Factor C 36kD Subunit, RF-C 36kD Subunit, RFC36, Activator 1 36kD Subunit, A1 36kD Subunit, MGC1155) (MaxLight 490)

Ask
View Details
Human Monoclonal MAGEA3 Antibody (21B4) [DyLight 680]
NBP3-20166FR 0.1 mL

Human Monoclonal MAGEA3 Antibody (21B4) [DyLight 680]

Ask
View Details
Rat P2Y purinoceptor 4 ELISA Kit
MBS7276012-01 48 Well

Rat P2Y purinoceptor 4 ELISA Kit

Ask
View Details
Rat P2Y purinoceptor 4 ELISA Kit
MBS7276012-02 96 Well

Rat P2Y purinoceptor 4 ELISA Kit

Ask
View Details
Rat P2Y purinoceptor 4 ELISA Kit
MBS7276012-03 5x 96 Well

Rat P2Y purinoceptor 4 ELISA Kit

Ask
View Details