Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (177 a.a)

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (177 a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-177-a-a.html

Purity

96.95

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-1 (E67-T243) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nakayama F, et al. Fibroblast growth factor-12 (FGF12) translocation into intestinal epithelial cells is dependent on a novel cell-penetrating peptide domain: involvement of internalization in the in vivo role of exogenous FGF12. J Biol Chem. 2011 Jul 22;286 (29) :25823-34.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R1B antibody
70R-19483 50 ul

PPP2R1B antibody

Sign In for Pricing
View Details
Beta Catenin Antibody
V3801-20UG 20 µg

Beta Catenin Antibody

Sign In for Pricing
View Details
Lentiviral human TNPO2 shRNA (UAS) - Lentiviral human TNPO2 shRNA (UAS, iRFP) (100)
GTR15347046 1 Vial

Lentiviral human TNPO2 shRNA (UAS) - Lentiviral human TNPO2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, RBP6, Retinoic Acid Binding Protein 6)
MBS622202-01 0.1 mg

CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, RBP6, Retinoic Acid Binding Protein 6)

Sign In for Pricing
View Details
CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, RBP6, Retinoic Acid Binding Protein 6)
MBS622202-02 5x 0.1 mg

CRABP2 (CRABP-2, CRABPII, CRABP-II, Cellular Retinoic Acid-Binding Protein 2, RBP6, Retinoic Acid Binding Protein 6)

Sign In for Pricing
View Details
Trp53i11 Protein Lysate (Mouse) with C-HA Tag
48499034 100 µg

Trp53i11 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details