Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (177 a.a)

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (177 a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-177-a-a.html

Purity

96.95

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-1 (E67-T243) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nakayama F, et al. Fibroblast growth factor-12 (FGF12) translocation into intestinal epithelial cells is dependent on a novel cell-penetrating peptide domain: involvement of internalization in the in vivo role of exogenous FGF12. J Biol Chem. 2011 Jul 22;286 (29) :25823-34.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WFDC9 Adenovirus (Mouse)

50413054 1.0 mL

WFDC9 Adenovirus (Mouse)

Ask

APOH (Apolipoprotein H, B2G1, BG, B2GP1) discontinued

209556-01 20 µL

APOH (Apolipoprotein H, B2G1, BG, B2GP1) discontinued

Ask

APOH (Apolipoprotein H, B2G1, BG, B2GP1) discontinued

209556-02 100 µL

APOH (Apolipoprotein H, B2G1, BG, B2GP1) discontinued

Ask

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (Biotin)

MBS6144680-01 0.1 mL

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (Biotin)

Ask

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (Biotin)

MBS6144680-02 5x 0.1 mL

SUPT5H (SPT5, SPT5H, Transcription Elongation Factor SPT5, DRB Sensitivity-inducing Factor 160kD Subunit, DRB Sensitivity-inducing Factor Large Subunit, Tat-cotransactivator 1 Protein, FLJ34157) (Biotin)

Ask

CD19, CT (CD19, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19) (MaxLight 550) discontinued

033466-ML550 100 µL

CD19, CT (CD19, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12, CD19) (MaxLight 550) discontinued

Ask