Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-12, Human (177 a.a)

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

Product Specifications

Product Name Alternative

FGF-12 Protein, Human (177 a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-12-protein-human-177-a-a.html

Purity

96.95

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-1 (E67-T243) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nakayama F, et al. Fibroblast growth factor-12 (FGF12) translocation into intestinal epithelial cells is dependent on a novel cell-penetrating peptide domain: involvement of internalization in the in vivo role of exogenous FGF12. J Biol Chem. 2011 Jul 22;286 (29) :25823-34.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SIVA (SIVA1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA506823S 30 µL

SIVA (SIVA1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]

Ask
View Details
Lentiviral mouse Smo shRNA (UAS) - Lentiviral mouse Smo shRNA (UAS, RFP) (25)
GTR15198767 1 Vial

Lentiviral mouse Smo shRNA (UAS) - Lentiviral mouse Smo shRNA (UAS, RFP) (25)

Ask
View Details
GUCA2A, ID (GUCA2A, GUCA2, Guanylin, Guanylate cyclase activator 2A, Guanylate cyclase-activating protein 1, Guanylate cyclase-activating protein I, HMW-guanylin) (MaxLight 490) discontinued
036383-ML490 100 µL

GUCA2A, ID (GUCA2A, GUCA2, Guanylin, Guanylate cyclase activator 2A, Guanylate cyclase-activating protein 1, Guanylate cyclase-activating protein I, HMW-guanylin) (MaxLight 490) discontinued

Ask
View Details
Recombinant Mouse Long-chain-fatty-acid--CoA ligase 1 (Acsl1)
MBS951297 Inquire

Recombinant Mouse Long-chain-fatty-acid--CoA ligase 1 (Acsl1)

Ask
View Details
Bovine Dentin Sialo protein ELISA Kit
MBS738743-01 48 Well

Bovine Dentin Sialo protein ELISA Kit

Ask
View Details
Bovine Dentin Sialo protein ELISA Kit
MBS738743-02 96 Well

Bovine Dentin Sialo protein ELISA Kit

Ask
View Details