Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 7 Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

GB

Abbreviation

Recombinant Human herpesvirus 7 gB protein, partial

Gene Name

GB

UniProt

P52352

Expression Region

23-259aa

Organism

Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Target Sequence

DFVMTGHNQHLPFRICSIATGTDLVRFDREVSCASYGSNIKTTEGILIIYKTKIEAHTFSVRTFKKELTFQTTYRDVGTVYFLDRTVTTLPMPIEEVHMVNTEARCLSSISVKRSEEEEYVAYHKDEYVNKTLDLIPLNFKSDTVRRYITTKEPFLRNGPLWFYSTSTSINCIVTDCIAKTKYPFDFFALSTGETVEGSPFYNGINSKTFNEPTEKILFRNNYTMLKTFDDGSKGNF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.4 kDa

References & Citations

"Determination and analysis of the complete nucleotide sequence of human herpesvirus." Nicholas J. J. Virol. 70:5975-5989 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vmn1r168 AAV Vector (Mouse) (CMV)
49571104 1 µg

Vmn1r168 AAV Vector (Mouse) (CMV)

Ask
View Details
Human C-Peptide ELISA Kit
NR-R10002 1 Each

Human C-Peptide ELISA Kit

Ask
View Details
EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (
MBS6131204-01 0.1 mL

EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (

Ask
View Details
EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (
MBS6131204-02 5x 0.1 mL

EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (

Ask
View Details
C9orf164 Human shRNA Lentiviral Particle (Locus ID 349236)
TL319910V 500 µL Each

C9orf164 Human shRNA Lentiviral Particle (Locus ID 349236)

Ask
View Details
Lentiviral mouse Ptk2 shRNA (UAS) - Lentiviral mouse Ptk2 shRNA (UAS, iRFP) (100)
GTR15188823 1 Vial

Lentiviral mouse Ptk2 shRNA (UAS) - Lentiviral mouse Ptk2 shRNA (UAS, iRFP) (100)

Ask
View Details