Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 7 Envelope glycoprotein B (gB), partial

Product Specifications

Product Name Alternative

GB

Abbreviation

Recombinant Human herpesvirus 7 gB protein, partial

Gene Name

GB

UniProt

P52352

Expression Region

23-259aa

Organism

Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Target Sequence

DFVMTGHNQHLPFRICSIATGTDLVRFDREVSCASYGSNIKTTEGILIIYKTKIEAHTFSVRTFKKELTFQTTYRDVGTVYFLDRTVTTLPMPIEEVHMVNTEARCLSSISVKRSEEEEYVAYHKDEYVNKTLDLIPLNFKSDTVRRYITTKEPFLRNGPLWFYSTSTSINCIVTDCIAKTKYPFDFFALSTGETVEGSPFYNGINSKTFNEPTEKILFRNNYTMLKTFDDGSKGNF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.4 kDa

References & Citations

"Determination and analysis of the complete nucleotide sequence of human herpesvirus." Nicholas J. J. Virol. 70:5975-5989 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAGEA9 (Melanoma-associated Antigen 9, MAGE-9 Antigen, Cancer/Testis Antigen 1.9, CT1.9, MAGE9, MAGEA9A, MGC8421) (PE)
MBS6384630-01 0.1 mL

MAGEA9 (Melanoma-associated Antigen 9, MAGE-9 Antigen, Cancer/Testis Antigen 1.9, CT1.9, MAGE9, MAGEA9A, MGC8421) (PE)

Ask
View Details
MAGEA9 (Melanoma-associated Antigen 9, MAGE-9 Antigen, Cancer/Testis Antigen 1.9, CT1.9, MAGE9, MAGEA9A, MGC8421) (PE)
MBS6384630-02 5x 0.1 mL

MAGEA9 (Melanoma-associated Antigen 9, MAGE-9 Antigen, Cancer/Testis Antigen 1.9, CT1.9, MAGE9, MAGEA9A, MGC8421) (PE)

Ask
View Details
MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25kD component) (AP) discontinued
038326-AP 200 µL

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25kD component) (AP) discontinued

Ask
View Details
His-Tag (6xHis)
553500 100 µg

His-Tag (6xHis)

Ask
View Details
MGD. sodium salt. monohydrate
MBS565446-01 50 mg

MGD. sodium salt. monohydrate

Ask
View Details
MGD. sodium salt. monohydrate
MBS565446-02 250 mg

MGD. sodium salt. monohydrate

Ask
View Details