Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 alpha chain (C8A)

Product Specifications

Product Name Alternative

Complement component 8 subunit alpha

Abbreviation

Recombinant Human C8A protein

Gene Name

C8A

UniProt

P07357

Expression Region

31-584aa

Organism

Homo sapiens (Human)

Target Sequence

AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-C3G Antibody, Affinity Purified
MBS3902392-01 0.002 mg

Rabbit anti-C3G Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-C3G Antibody, Affinity Purified
MBS3902392-02 0.02 mg

Rabbit anti-C3G Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-C3G Antibody, Affinity Purified
MBS3902392-03 5x 0.002 mg

Rabbit anti-C3G Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-C3G Antibody, Affinity Purified
MBS3902392-04 5x 0.02 mg

Rabbit anti-C3G Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit Anti-Human ZnT-1 Polyclonal Antibody
PA90753HU-01 50 µg

Rabbit Anti-Human ZnT-1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ZnT-1 Polyclonal Antibody
PA90753HU-02 100 µg

Rabbit Anti-Human ZnT-1 Polyclonal Antibody

Sign In for Pricing
View Details