Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2D/CD314, Cynomolgus (HEK293, His)

The NKG2D/CD314 protein serves as an important activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells, activates NK cells and serves as a costimulatory receptor for CD8 (+) T cell-mediated adaptive responses, thereby enhancing T cell activation. NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NKG2D/CD314 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2d-cd314-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

Molecular Formula

102120479 (Gene_ID) P61252 (F78-V216) (Accession)

Molecular Weight

22-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MERS-CoV RBD Human Monoclonal Antibody
orb2959357-01 50 µg

MERS-CoV RBD Human Monoclonal Antibody

Sign In for Pricing
View Details
MERS-CoV RBD Human Monoclonal Antibody
orb2959357-02 100 µg

MERS-CoV RBD Human Monoclonal Antibody

Sign In for Pricing
View Details
MERS-CoV RBD Human Monoclonal Antibody
orb2959357-03 1 mg

MERS-CoV RBD Human Monoclonal Antibody

Sign In for Pricing
View Details
Disulfo-ICG carboxylic acid
T86278-01 100 mg

Disulfo-ICG carboxylic acid

Sign In for Pricing
View Details
Disulfo-ICG carboxylic acid
T86278-02 25 mg

Disulfo-ICG carboxylic acid

Sign In for Pricing
View Details
Disulfo-ICG carboxylic acid
T86278-03 50 mg

Disulfo-ICG carboxylic acid

Sign In for Pricing
View Details