CRY1, Human (His, Myc)
CRY1 Protein, Human (His, Myc) is the recombinant human-derived CRY1, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of CRY1 Protein, Human (His, Myc) is 586 a.a.
Product Specifications
Product Name Alternative
CRY1 Protein, Human (His, Myc), Human, E. coli
UNSPSC
12352202
Purity
90.00
Smiles
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Molecular Formula
1407 (Gene_ID) Q16526 (M1-N586) (Accession)
Molecular Weight
Approximately 80 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-25760 100 µL
Rabbit Monoclonal YTHDC2 Antibody (HL1862) - Azide and BSA Free
Sign In for Pricing
View Details RRA88617 250 mg
5,5-dimethyl-2- (((4-methylthiophenyl) amino) methylene) cyclohexane-1,3-dione
Sign In for Pricing
View Details 
32780-05171 5x 30 µg
Human NSL1 AssayLite™ Antibody (PerCP Conjugate)
Sign In for Pricing
View Details