Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRY1, Human (His, Myc)

CRY1 Protein, Human (His, Myc) is the recombinant human-derived CRY1, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of CRY1 Protein, Human (His, Myc) is 586 a.a.

Product Specifications

Product Name Alternative

CRY1 Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Purity

90.00

Smiles

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

Molecular Formula

1407 (Gene_ID) Q16526 (M1-N586) (Accession)

Molecular Weight

Approximately 80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GTF2H3 Recombinant Protein Antigen
NBP2-30371PEP 0.1 mL

GTF2H3 Recombinant Protein Antigen

Ask
View Details
Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit
MBS7257154-01 48 Well

Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit

Ask
View Details
Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit
MBS7257154-02 96 Well

Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit

Ask
View Details
Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit
MBS7257154-03 5x 96 Well

Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit

Ask
View Details
Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit
MBS7257154-04 10x 96 Well

Rabbit Phospho Cyclic AMP Response Element Binding Protein ELISA Kit

Ask
View Details
Lentiviral mouse Trim61 shRNA (UAS) - Lentiviral mouse Trim61 shRNA (UAS, iRFP) (100)
GTR15302766 1 Vial

Lentiviral mouse Trim61 shRNA (UAS) - Lentiviral mouse Trim61 shRNA (UAS, iRFP) (100)

Ask
View Details