Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR7, Mouse (His, Myc)

The TLR7 protein is an endosomal receptor critical in innate and adaptive immunity that recognizes uridine-containing single-stranded RNA (ssRNA) or guanosine analogs in viruses, thereby controlling the host immune response. Upon agonist binding, TLR7 dimerizes, activates the Myddosome complex and recruits downstream adapters. TLR7 Protein, Mouse (His) is the recombinant mouse-derived TLR7 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

TLR7 Protein, Mouse (His, Myc), Mouse, E. coli

UNSPSC

12352202

Smiles

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Molecular Formula

170743 (Gene_ID) P58681 (F27-S348) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzil
TRC-B196970-5G 5 g

Benzil

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS500189 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
RBFOX2 (NM_001082576) Human Over-expression Lysate
LC421191 20 µg

RBFOX2 (NM_001082576) Human Over-expression Lysate

Sign In for Pricing
View Details
6'-Chloro-2',3'-dihydro-spiro[1,3-dioxolane-2,4'-[4H]thieno[3,2-e][1,2]thiazine] 1',1'-Dioxide
TRC-C365830-25MG 25 mg

6'-Chloro-2',3'-dihydro-spiro[1,3-dioxolane-2,4'-[4H]thieno[3,2-e][1,2]thiazine] 1',1'-Dioxide

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP620606 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]
AM26145AC-N 100 Tests

CD99 Mouse Monoclonal Antibody [Clone ID: 3B2/TA8]

Sign In for Pricing
View Details