Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO22, Human (His)

FBXO22 Protein, Human (His) is the recombinant human-derived FBXO22, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FBXO22 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK

Molecular Formula

26263 (Gene_ID) Q8NEZ5 (M1-K403) (Accession)

Molecular Weight

Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD281/TLR1, N-His
ARO-P13361-01 50 µg

Recombinant Human CD281/TLR1, N-His

Sign In for Pricing
View Details
Recombinant Human CD281/TLR1, N-His
ARO-P13361-02 100 µg

Recombinant Human CD281/TLR1, N-His

Sign In for Pricing
View Details
Recombinant Human CD281/TLR1, N-His
ARO-P13361-03 1 mg

Recombinant Human CD281/TLR1, N-His

Sign In for Pricing
View Details
Human Probable peptidyl-tRNA hydrolase (PTRH1) ELISA Kit
orb1655536-01 48 Tests

Human Probable peptidyl-tRNA hydrolase (PTRH1) ELISA Kit

Sign In for Pricing
View Details
Human Probable peptidyl-tRNA hydrolase (PTRH1) ELISA Kit
orb1655536-02 96 Tests

Human Probable peptidyl-tRNA hydrolase (PTRH1) ELISA Kit

Sign In for Pricing
View Details
Dehydroepiandrosterone (DHEA) (APC)
MBS6268727-01 0.1 mL

Dehydroepiandrosterone (DHEA) (APC)

Sign In for Pricing
View Details