Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caveolin-1/CAV1, Human (Cell-Free, His)

Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

Caveolin-1/CAV1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Purity

94.00

Smiles

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Molecular Formula

857 (Gene_ID) Q03135 (M1-I178) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARRDC3 Human Gene Knockout Kit (CRISPR)
KN208809 1 Kit

ARRDC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SerpinB12/SERPINB12 Protein (His Tag)
PKSH033037-01 10 µg

Recombinant Human SerpinB12/SERPINB12 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SerpinB12/SERPINB12 Protein (His Tag)
PKSH033037-02 50 µg

Recombinant Human SerpinB12/SERPINB12 Protein (His Tag)

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) (C-term) Rabbit Polyclonal Antibody
AP17441PU-N 400 µL

Glutathione Synthetase (GSS) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]
TA396832 100 µg

MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-3), CF568 conjugate, 0.1mg/mL
BNC682495-500 1x 500 µL

Lactoylglutathione Lyase (CPTC-GLO1-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details