Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caveolin-1/CAV1, Human (Cell-Free, His)

Caveolin-1/CAV1 protein is an important scaffold component in the caveolae membrane, forming a stable complex with CAV2 to guide caveolar formation and lipid raft positioning. It recruits CAVIN proteins (CAVIN1/2/3/4) to caveolae, thereby increasing the complexity of cell signaling. Caveolin-1/CAV1 Protein, Human (Cell-Free, His) is the recombinant human-derived Caveolin-1/CAV1, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

Caveolin-1/CAV1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Purity

94.00

Smiles

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Molecular Formula

857 (Gene_ID) Q03135 (M1-I178) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBNDD1 Human Gene Knockout Kit (CRISPR)
KN400971 1 Kit

DBNDD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
0610009B22Rik (NM_025319) Mouse Tagged ORF Clone
MG200879 10 µg

0610009B22Rik (NM_025319) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2,5-Dichloro-4-nitrophenol
TRC-D435558-10MG 10 mg

2,5-Dichloro-4-nitrophenol

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560583 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
D-(+)-Alpha-Bromocamphor-8-sulfonic Acid Ammonium Salt
TRC-B682090-5G 5 g

D-(+)-Alpha-Bromocamphor-8-sulfonic Acid Ammonium Salt

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3004
BAVT-3004 1 Unit

Vertical Autoclave BAVT-3004

Sign In for Pricing
View Details