Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC17A, Human (HEK293, hFc)

CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CLEC17A Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Smiles

KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC

Molecular Formula

388512 (Gene_ID) Q6ZS10-1 (K194-C378) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxl3 (1-5) Rabbit Polyclonal Antibody
AP26069PU-N 100 µL

Fbxl3 (1-5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-(1-Piperazinyl)-2-pyridinamine
TRC-P482423-500MG 500 mg

5-(1-Piperazinyl)-2-pyridinamine

Sign In for Pricing
View Details
Ghrelin O acyltransferase (MBOAT4) Rabbit Polyclonal Antibody
TA368370 100 µL

Ghrelin O acyltransferase (MBOAT4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-(2-Chloro-5-nitrophenyl)-2,5-dihydro-1H-pyrrole-2,5-dione (~85%)
TRC-C613690-50MG 50 mg

1-(2-Chloro-5-nitrophenyl)-2,5-dihydro-1H-pyrrole-2,5-dione (~85%)

Sign In for Pricing
View Details
SuperLight™ Dual Luciferase Reporter Gene Assay Kit
SLDL-100 100 Tests

SuperLight™ Dual Luciferase Reporter Gene Assay Kit

Sign In for Pricing
View Details
JDP2 (NM_001135047) Human Over-expression Lysate
LC427534 20 µg

JDP2 (NM_001135047) Human Over-expression Lysate

Sign In for Pricing
View Details