Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC17A, Human (HEK293, hFc)

CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CLEC17A Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Smiles

KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC

Molecular Formula

388512 (Gene_ID) Q6ZS10-1 (K194-C378) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf187 Mouse Gene Knockout Kit (CRISPR)
KN514931 1 Kit

Rnf187 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFluor® 510 succinimidyl ester
1424-AAT 1 mg

IFluor® 510 succinimidyl ester

Sign In for Pricing
View Details
Histiocytoma Marker (D11), CF568 conjugate, 0.1mg/mL
BNC680348-500 1x 500 µL

Histiocytoma Marker (D11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,4-Oxadiazol-3-amine
TRC-E590028-10MG 10 mg

1,2,4-Oxadiazol-3-amine

Sign In for Pricing
View Details
2,4-Diphenyl-1-butene
TRC-D283930-500MG 500 mg

2,4-Diphenyl-1-butene

Sign In for Pricing
View Details
SOX9 Recombinant Rabbit monoclonal Antibody
HA751478 100 µL

SOX9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details