Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement factor H/CFH, Human (HEK293, His)

Complement factor H/CFH Protein, Human (HEK293, His) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].

Product Specifications

Product Name Alternative

Complement factor H/CFH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

96.00

Smiles

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

Molecular Formula

3075 (Gene_ID) P08603-2 (E19-L449) (Accession)

Molecular Weight

Approximately 49-54 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-01 0.02 mg (E-Coli)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-02 0.02 mg (Yeast)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-03 0.1 mg (E-Coli)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-04 0.1 mg (Yeast)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-05 0.02 mg (Baculovirus)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein C (IQCC)
MBS1366031-06 0.02 mg (Mammalian-Cell)

Recombinant Human IQ domain-containing protein C (IQCC)

Sign In for Pricing
View Details