Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement factor H/CFH, Human (HEK293, His)

Complement factor H/CFH Protein, Human (HEK293, His) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].

Product Specifications

Product Name Alternative

Complement factor H/CFH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

96.00

Smiles

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

Molecular Formula

3075 (Gene_ID) P08603-2 (E19-L449) (Accession)

Molecular Weight

Approximately 49-54 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (AcK56) polyclonal antibody
orb1678336-01 50 µL

Histone H3 (AcK56) polyclonal antibody

Sign In for Pricing
View Details
Histone H3 (AcK56) polyclonal antibody
orb1678336-02 100 µL

Histone H3 (AcK56) polyclonal antibody

Sign In for Pricing
View Details
Histone H3 (AcK56) polyclonal antibody
orb1678336-03 200 µL

Histone H3 (AcK56) polyclonal antibody

Sign In for Pricing
View Details
Hoxa6 ORF Vector (Mouse) (pORF)
ORF047392 1.0 µg DNA

Hoxa6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Slc25a42 Pre-designed siRNA Set B
SI213049B 1 Each

Rat Slc25a42 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Goat Anti-Mouse IgM, μ chain Polyclonal Antibody
PTX20810-01 50 µg

Goat Anti-Mouse IgM, μ chain Polyclonal Antibody

Sign In for Pricing
View Details