Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement factor H/CFH, Human (HEK293, His)

Complement factor H/CFH Protein, Human (HEK293, His) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].

Product Specifications

Product Name Alternative

Complement factor H/CFH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

96.00

Smiles

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

Molecular Formula

3075 (Gene_ID) P08603-2 (E19-L449) (Accession)

Molecular Weight

Approximately 49-54 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOZ/MYST3 Antibody (C-term)
orb30176-01 50 µL

MOZ/MYST3 Antibody (C-term)

Sign In for Pricing
View Details
MOZ/MYST3 Antibody (C-term)
orb30176-02 100 µL

MOZ/MYST3 Antibody (C-term)

Sign In for Pricing
View Details
Sodium Lauryl Sulphate (Needle-Shape) Extrapure
244200500 500 mg

Sodium Lauryl Sulphate (Needle-Shape) Extrapure

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (PE)
247620-PE 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (PE)

Sign In for Pricing
View Details
Hamster Proprotein Convertase Subtilisin/Kexin Type 2 ELISA Kit
MBS069151-01 48 Well

Hamster Proprotein Convertase Subtilisin/Kexin Type 2 ELISA Kit

Sign In for Pricing
View Details
Hamster Proprotein Convertase Subtilisin/Kexin Type 2 ELISA Kit
MBS069151-02 96 Well

Hamster Proprotein Convertase Subtilisin/Kexin Type 2 ELISA Kit

Sign In for Pricing
View Details