Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPA33, Cynomolgus (HEK293, His)

The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..

Product Specifications

Product Name Alternative

GPA33 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Smiles

WPVLWTLCAVRVTVNAITVETSQNVLRALHGKSVTLPCTYHTSTSSREGLIQWDKLLFTHTERVVIWQFSNKDYIYGELYKNRVNISSNVEQSDASITIDQLTMADNGTYECSVSLMSDLDGTTKSRVRLLVLLPPSKPECGIEGETIIGNDIQLTCQSKEGSPTPQYSWKRYDILNQEQPLAQPASGQPVSLKNVSTDTSGYYICTSSNEAGI

Molecular Formula

101867278 (Gene_ID) G7NU40-1 (I38-V251) (Accession)

Molecular Weight

Approximately 35-38 kDa & 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL
BNC881788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL
BNC471784-100 1x 100 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (CD68/G2), CF405S conjugate, 0.1mg/mL
BNC040919-100 1x 100 µL

CD68 (CD68/G2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details