Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PADI2, Cynomolgus (sf9, His)

The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.

Product Specifications

Product Name Alternative

PADI2 Protein, Cynomolgus (sf9, His), Cynomolgus, sf9 insect cells

UNSPSC

12352202

Smiles

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

Molecular Formula

/ (Gene_ID) A0A2K5TST4 (M1-P665) (Accession)

Molecular Weight

Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details
Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-02 0.02 mg (Yeast)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details
Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-03 0.1 mg (E-Coli)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details
Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-04 0.1 mg (Yeast)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details
Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-05 0.02 mg (Baculovirus)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details
Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)
MBS1208761-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus anthracis Hydroxyethylthiazole kinase (thiM)

Ask
View Details