PADI2, Cynomolgus (sf9, His)
The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.
Product Specifications
Product Name Alternative
PADI2 Protein, Cynomolgus (sf9, His), Cynomolgus, sf9 insect cells
UNSPSC
12352202
Smiles
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP
Molecular Formula
/ (Gene_ID) A0A2K5TST4 (M1-P665) (Accession)
Molecular Weight
Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
GTR15156826 1 Vial
Lentiviral human AVPR2 shRNA (UAS) - Lentiviral human AVPR2 shRNA (UAS, GFP) plasmid
Ask
View Details 